| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
| Protein automated matches [190123] (158 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225477] (15 PDB entries) |
| Domain d3pewa2: 3pew A:287-481 [265178] automated match to d3rrma2 protein/RNA complex; complexed with adp, bef, mg, no3 |
PDB Entry: 3pew (more details), 1.5 Å
SCOPe Domain Sequences for d3pewa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pewa2 c.37.1.0 (A:287-481) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pnantlelqtnevnvdaikqlymdckneadkfdvltelygvmtigssiifvatkktanvl
ygklkseghevsilhgdlqtqerdrliddfregrskvlittnvlargidiptvsmvvnyd
lptlangqadpatyihrigrtgrfgrkgvaisfvhdknsfnilsaiqkyfgdiemtrvpt
ddwdevekivkkvlk
Timeline for d3pewa2: