SCOPe 2.08: Domain d3p93h2: 3p93 H:114-405

Lineage for d3p93h2 (3p93 H:114-405)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (79 species)
   not a true protein

7. Species Chromohalobacter salexigens [TaxId:158080] [267865] (6 PDB entries)

8. Domain d3p93h2: 3p93 H:114-405 [265174]
   Other proteins in same PDB: d3p93a1, d3p93a3, d3p93b1, d3p93b3, d3p93c1, d3p93c3, d3p93d1, d3p93d3, d3p93e1, d3p93e3, d3p93f1, d3p93f3, d3p93g1, d3p93g3, d3p93h1, d3p93h3
   automated match to d4il2a2
   complexed with cs2, kdg, mg

Details for d3p93h2

PDB Entry: 3p93, 1.8 Å

PDB Description: Crystal structure of D-mannonate dehydratase from Chromohalobacter Salexigens complexed with MG,D-Mannonate and 2-keto-3-deoxy-D-Gluconate

PDB Compounds: (H:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3p93h2:

Sequence, based on SEQRES records:

>d3p93h2 c.1.11.0 (H:114-405) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryep
adsslpaehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepy
hlfwledcvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgg
gitamrrvadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdav
fphdyrfedghflagespghgvdideelaakypyeraslpvnrledgtlwhw

Sequence, based on observed residues (ATOM records):

>d3p93h2 c.1.11.0 (H:114-405) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgslpaehvwstekylnha
pklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrli
rehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtg
fhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespgh
gvdideelaakypyeraslpvnrledgtlwhw

Timeline for d3p93h2:

• d3p93h2 first appeared in SCOPe 2.05
  
• d3p93h2 appears in SCOPe 2.07