| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (95 species) not a true protein |
| Species Chromohalobacter salexigens [TaxId:158080] [267864] (6 PDB entries) |
| Domain d3p93g1: 3p93 G:4-113 [265171] Other proteins in same PDB: d3p93a2, d3p93a3, d3p93b2, d3p93b3, d3p93c2, d3p93c3, d3p93d2, d3p93d3, d3p93e2, d3p93e3, d3p93f2, d3p93f3, d3p93g2, d3p93g3, d3p93h2, d3p93h3 automated match to d4il2a1 complexed with cs2, kdg, mg |
PDB Entry: 3p93 (more details), 1.8 Å
SCOPe Domain Sequences for d3p93g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p93g1 d.54.1.0 (G:4-113) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
kirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrdag
riedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllgg
Timeline for d3p93g1: