![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
![]() | Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
![]() | Protein automated matches [226923] (79 species) not a true protein |
![]() | Species Chromohalobacter salexigens [TaxId:158080] [267865] (6 PDB entries) |
![]() | Domain d3p93f2: 3p93 F:114-405 [265170] Other proteins in same PDB: d3p93a1, d3p93a3, d3p93b1, d3p93b3, d3p93c1, d3p93c3, d3p93d1, d3p93d3, d3p93e1, d3p93e3, d3p93f1, d3p93f3, d3p93g1, d3p93g3, d3p93h1, d3p93h3 automated match to d4il2a2 complexed with cs2, kdg, mg |
PDB Entry: 3p93 (more details), 1.8 Å
SCOPe Domain Sequences for d3p93f2:
Sequence, based on SEQRES records: (download)
>d3p93f2 c.1.11.0 (F:114-405) automated matches {Chromohalobacter salexigens [TaxId: 158080]} ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryep adsslpaehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepy hlfwledcvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgg gitamrrvadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdav fphdyrfedghflagespghgvdideelaakypyeraslpvnrledgtlwhw
>d3p93f2 c.1.11.0 (F:114-405) automated matches {Chromohalobacter salexigens [TaxId: 158080]} ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgslpaehvwstekylnha pklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrli rehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtg fhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespgh gvdideelaakypyeraslpvnrledgtlwhw
Timeline for d3p93f2: