Lineage for d1bwba_ (1bwb A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily) Superfamily b.50.1: Acid proteases [50630] (2 families) 
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins) Protein Human immunodeficiency virus type 1 protease [50632] (1 species) Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (108 PDB entries) 
Domain d1bwba_: 1bwb A: [26517]
Details for d1bwba_
PDB Entry: 1bwb (more details), 1.8 Å
PDB Description: hiv-1 protease (v82f/i84v) double mutant complexed with sd146 of dupont pharmaceuticals
SCOP Domain Sequences for d1bwba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bwba_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpfnvigrnlltqigctlnf
SCOP Domain Coordinates for d1bwba_:
Click to download the PDB-style file with coordinates for d1bwba_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bwba_:
- d1bwba_ appears in SCOP 1.57
- d1bwba_ appears in the current release, SCOPe 2.08
View in 3D
