Lineage for d3p93e2 (3p93 E:114-405)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837377Species Chromohalobacter salexigens [TaxId:158080] [267865] (6 PDB entries)
  8. 2837414Domain d3p93e2: 3p93 E:114-405 [265168]
    Other proteins in same PDB: d3p93a1, d3p93a3, d3p93b1, d3p93b3, d3p93c1, d3p93c3, d3p93d1, d3p93d3, d3p93e1, d3p93e3, d3p93f1, d3p93f3, d3p93g1, d3p93g3, d3p93h1, d3p93h3
    automated match to d4il2a2
    complexed with cs2, kdg, mg

Details for d3p93e2

PDB Entry: 3p93 (more details), 1.8 Å

PDB Description: Crystal structure of D-mannonate dehydratase from Chromohalobacter Salexigens complexed with MG,D-Mannonate and 2-keto-3-deoxy-D-Gluconate
PDB Compounds: (E:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3p93e2:

Sequence, based on SEQRES records: (download)

>d3p93e2 c.1.11.0 (E:114-405) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryep
adsslpaehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepy
hlfwledcvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgg
gitamrrvadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdav
fphdyrfedghflagespghgvdideelaakypyeraslpvnrledgtlwhw

Sequence, based on observed residues (ATOM records): (download)

>d3p93e2 c.1.11.0 (E:114-405) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgepadsslpaehvwstek
ylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqe
slrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlasly
hvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflag
espghgvdideelaakypyeraslpvnrledgtlwhw

SCOPe Domain Coordinates for d3p93e2:

Click to download the PDB-style file with coordinates for d3p93e2.
(The format of our PDB-style files is described here.)

Timeline for d3p93e2: