Lineage for d1hxwb_ (1hxw B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15694Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 15695Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 15696Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)
  6. 15712Protein Human immunodeficiency virus type 1 protease [50632] (1 species)
  7. 15713Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (108 PDB entries)
  8. 15735Domain d1hxwb_: 1hxw B: [26516]

Details for d1hxwb_

PDB Entry: 1hxw (more details), 1.8 Å

PDB Description: hiv-1 protease dimer complexed with a-84538

SCOP Domain Sequences for d1hxwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxwb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf

SCOP Domain Coordinates for d1hxwb_:

Click to download the PDB-style file with coordinates for d1hxwb_.
(The format of our PDB-style files is described here.)

Timeline for d1hxwb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hxwa_