| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
| Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
| Protein automated matches [190896] (11 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries) |
| Domain d3p6yh_: 3p6y H: [265154] automated match to d4c7qa_ protein/RNA complex |
PDB Entry: 3p6y (more details), 2.9 Å
SCOPe Domain Sequences for d3p6yh_:
Sequence, based on SEQRES records: (download)
>d3p6yh_ d.58.7.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskklmd
llpkrelhgqnpvvtp
>d3p6yh_ d.58.7.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lyignltwwttdedlteavhslvndileikffenrangqskgfalvgvseasskklmdll
pkrelhgqnpvvtp
Timeline for d3p6yh_: