Lineage for d3p5tl_ (3p5t L:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2952471Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2952472Protein automated matches [190896] (11 species)
    not a true protein
  7. 2952511Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries)
  8. 2952563Domain d3p5tl_: 3p5t L: [265145]
    automated match to d4c7qa_
    protein/RNA complex

Details for d3p5tl_

PDB Entry: 3p5t (more details), 2.7 Å

PDB Description: CFIm25-CFIm68 complex
PDB Compounds: (L:) Cleavage and polyadenylation specificity factor subunit 6

SCOPe Domain Sequences for d3p5tl_:

Sequence, based on SEQRES records: (download)

>d3p5tl_ d.58.7.0 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskklmd
llpkrelhgqnpvvtps

Sequence, based on observed residues (ATOM records): (download)

>d3p5tl_ d.58.7.0 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvseasskklmdl
lpkrelhgqnpvvtps

SCOPe Domain Coordinates for d3p5tl_:

Click to download the PDB-style file with coordinates for d3p5tl_.
(The format of our PDB-style files is described here.)

Timeline for d3p5tl_: