Class b: All beta proteins [48724] (180 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.5: Actin-crosslinking proteins [50405] (3 families) |
Family b.42.5.0: automated matches [267627] (1 protein) not a true family |
Protein automated matches [267678] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [267866] (2 PDB entries) |
Domain d3p53b3: 3p53 B:260-382 [265143] automated match to d3llpa3 complexed with 12p, 1pe, gol, pg0 |
PDB Entry: 3p53 (more details), 2 Å
SCOPe Domain Sequences for d3p53b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p53b3 b.42.5.0 (B:260-382) automated matches {Human (Homo sapiens) [TaxId: 9606]} caqvvlqaanernvstrqgmdlsanqdeetdqetfqleidrdtkkcafrthtgkywtlta tggvqstassknascyfdiewrdrritlrasngkfvtskkngqlaasvetagdselflmk lin
Timeline for d3p53b3:
View in 3D Domains from other chains: (mouse over for more information) d3p53a1, d3p53a2, d3p53a3, d3p53a4 |