Lineage for d3ow1h1 (3ow1 H:4-113)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948060Species Chromohalobacter salexigens [TaxId:158080] [267864] (6 PDB entries)
  8. 2948092Domain d3ow1h1: 3ow1 H:4-113 [265135]
    Other proteins in same PDB: d3ow1a2, d3ow1a3, d3ow1b2, d3ow1b3, d3ow1c2, d3ow1c3, d3ow1d2, d3ow1d3, d3ow1e2, d3ow1e3, d3ow1f2, d3ow1f3, d3ow1g2, d3ow1g3, d3ow1h2, d3ow1h3
    automated match to d4il2a1
    complexed with gol, mg, so4

Details for d3ow1h1

PDB Entry: 3ow1 (more details), 1.8 Å

PDB Description: Crystal structure of D-mannonate dehydratase from Chromohalobacter salexigens complexed with MG
PDB Compounds: (H:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3ow1h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ow1h1 d.54.1.0 (H:4-113) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
kirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrdag
riedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllgg

SCOPe Domain Coordinates for d3ow1h1:

Click to download the PDB-style file with coordinates for d3ow1h1.
(The format of our PDB-style files is described here.)

Timeline for d3ow1h1: