![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
![]() | Protein automated matches [226922] (95 species) not a true protein |
![]() | Species Chromohalobacter salexigens [TaxId:158080] [267864] (6 PDB entries) |
![]() | Domain d3ow1f1: 3ow1 F:4-113 [265131] Other proteins in same PDB: d3ow1a2, d3ow1a3, d3ow1b2, d3ow1b3, d3ow1c2, d3ow1c3, d3ow1d2, d3ow1d3, d3ow1e2, d3ow1e3, d3ow1f2, d3ow1f3, d3ow1g2, d3ow1g3, d3ow1h2, d3ow1h3 automated match to d4il2a1 complexed with gol, mg, so4 |
PDB Entry: 3ow1 (more details), 1.8 Å
SCOPe Domain Sequences for d3ow1f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ow1f1 d.54.1.0 (F:4-113) automated matches {Chromohalobacter salexigens [TaxId: 158080]} kirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrdag riedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllgg
Timeline for d3ow1f1: