SCOPe 2.08: Domain d3ow1d2: 3ow1 D:114-405

Lineage for d3ow1d2 (3ow1 D:114-405)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (79 species)
   not a true protein

7. Species Chromohalobacter salexigens [TaxId:158080] [267865] (6 PDB entries)

8. Domain d3ow1d2: 3ow1 D:114-405 [265128]
   Other proteins in same PDB: d3ow1a1, d3ow1a3, d3ow1b1, d3ow1b3, d3ow1c1, d3ow1c3, d3ow1d1, d3ow1d3, d3ow1e1, d3ow1e3, d3ow1f1, d3ow1f3, d3ow1g1, d3ow1g3, d3ow1h1, d3ow1h3
   automated match to d4il2a2
   complexed with gol, mg, so4

Details for d3ow1d2

PDB Entry: 3ow1, 1.8 Å

PDB Description: Crystal structure of D-mannonate dehydratase from Chromohalobacter salexigens complexed with MG

PDB Compounds: (D:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3ow1d2:

Sequence, based on SEQRES records:

>d3ow1d2 c.1.11.0 (D:114-405) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryep
adsslpaehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepy
hlfwledcvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgg
gitamrrvadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdav
fphdyrfedghflagespghgvdideelaakypyeraslpvnrledgtlwhw

Sequence, based on observed residues (ATOM records):

>d3ow1d2 c.1.11.0 (D:114-405) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgpadsslpaehvwsteky
lnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqes
lrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyh
vrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflage
spghgvdideelaakypyeraslpvnrledgtlwhw

Timeline for d3ow1d2:

• d3ow1d2 first appeared in SCOPe 2.05
  
• d3ow1d2 appears in SCOPe 2.07