![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) ![]() Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
![]() | Family b.82.2.15: proly-4-hydroxylase (P4H, PHD) like [254173] (3 proteins) Pfam PF13640; PubMed 16782814 |
![]() | Protein automated matches [254532] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255179] (33 PDB entries) |
![]() | Domain d3ouia_: 3oui A: [265120] automated match to d2y34a_ complexed with 42z, act, fe2, peg |
PDB Entry: 3oui (more details), 1.7 Å
SCOPe Domain Sequences for d3ouia_:
Sequence, based on SEQRES records: (download)
>d3ouia_ b.82.2.15 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} palklaleyivpcmnkhgicvvddflgketgqqigdevralhdtgkftdgqlvsqksdss kdirgdkitwiegkepgcetigllmssmddlirhcngklgsykingrtkamvacypgngt gyvrhvdnpngdgrcvtciyylnkdwdakvsggilrifpegkaqfadiepkfdrllffws drrnphevqpayatryaitvwyfd
>d3ouia_ b.82.2.15 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} palklaleyivpcmnkhgicvvddflgketgqqigdevralhdtgkftdgqdirgdkitw iegkepgcetigllmssmddlirhcngklgsykingrtkamvacypgngtgyvrhvdnpr cvtciyylnkdwdakvsggilrifpegkaqfadiepkfdrllffwsdrrnphevqpayat ryaitvwyfd
Timeline for d3ouia_: