SCOPe 2.07: Domain d3ouia_: 3oui A:

Lineage for d3ouia_ (3oui A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.15: proly-4-hydroxylase (P4H, PHD) like [254173] (3 proteins)
   Pfam PF13640; PubMed 16782814

6. Protein automated matches [254532] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255179] (26 PDB entries)

8. Domain d3ouia_: 3oui A: [265120]
   automated match to d2y34a_
   complexed with 42z, act, fe2, peg

Details for d3ouia_

PDB Entry: 3oui, 1.7 Å

PDB Description: phd2-r717 with 40787422

PDB Compounds: (A:) Egl nine homolog 1

SCOPe Domain Sequences for d3ouia_:

Sequence, based on SEQRES records:

>d3ouia_ b.82.2.15 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
palklaleyivpcmnkhgicvvddflgketgqqigdevralhdtgkftdgqlvsqksdss
kdirgdkitwiegkepgcetigllmssmddlirhcngklgsykingrtkamvacypgngt
gyvrhvdnpngdgrcvtciyylnkdwdakvsggilrifpegkaqfadiepkfdrllffws
drrnphevqpayatryaitvwyfd

Sequence, based on observed residues (ATOM records):

>d3ouia_ b.82.2.15 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
palklaleyivpcmnkhgicvvddflgketgqqigdevralhdtgkftdgqdirgdkitw
iegkepgcetigllmssmddlirhcngklgsykingrtkamvacypgngtgyvrhvdnpr
cvtciyylnkdwdakvsggilrifpegkaqfadiepkfdrllffwsdrrnphevqpayat
ryaitvwyfd

Timeline for d3ouia_:

• d3ouia_ first appeared in SCOPe 2.05
  
• d3ouia_ appears in SCOPe 2.06