SCOPe 2.07: Domain d3oq2a_: 3oq2 A:

Lineage for d3oq2a_ (3oq2 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.58: CRISPR associated protein Cas2-like [143430] (2 families)
   contains extra C-terminal beta-strand that integrates into the beta-sheet of the other subunit in the homodimer, a probable biological unit of this superfamily

5. Family d.58.58.0: automated matches [191564] (1 protein)
   not a true family

6. Protein automated matches [190980] (6 species)
   not a true protein

7. Species Desulfovibrio vulgaris [TaxId:882] [267863] (1 PDB entry)

8. Domain d3oq2a_: 3oq2 A: [265118]
   automated match to d4qr0a_
   complexed with cit, cl, na, so4, trs

Details for d3oq2a_

PDB Entry: 3oq2, 1.35 Å

PDB Description: structure of a crispr associated protein cas2 from desulfovibrio vulgaris

PDB Compounds: (A:) CRISPR-associated protein Cas2

SCOPe Domain Sequences for d3oq2a_:

Sequence; same for both SEQRES and ATOM records:

>d3oq2a_ d.58.58.0 (A:) automated matches {Desulfovibrio vulgaris [TaxId: 882]}
ndamlvlisydvsfedpggqrrlrriakacqdygqrvqysvfecvvdpaqwaklkhrlls
emdkekdclrfyylganwrnkvehvgakpaydpegplil

Timeline for d3oq2a_:

• d3oq2a_ first appeared in SCOPe 2.05
  
• d3oq2a_ appears in SCOPe 2.06
  
• d3oq2a_ appears in the current release, SCOPe 2.08