| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.58: CRISPR associated protein Cas2-like [143430] (2 families) ![]() contains extra C-terminal beta-strand that integrates into the beta-sheet of the other subunit in the homodimer, a probable biological unit of this superfamily |
| Family d.58.58.0: automated matches [191564] (1 protein) not a true family |
| Protein automated matches [190980] (6 species) not a true protein |
| Species Desulfovibrio vulgaris [TaxId:882] [267863] (1 PDB entry) |
| Domain d3oq2a_: 3oq2 A: [265118] automated match to d4qr0a_ complexed with cit, cl, na, so4, trs |
PDB Entry: 3oq2 (more details), 1.35 Å
SCOPe Domain Sequences for d3oq2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oq2a_ d.58.58.0 (A:) automated matches {Desulfovibrio vulgaris [TaxId: 882]}
ndamlvlisydvsfedpggqrrlrriakacqdygqrvqysvfecvvdpaqwaklkhrlls
emdkekdclrfyylganwrnkvehvgakpaydpegplil
Timeline for d3oq2a_: