Lineage for d3obta1 (3obt A:863-1067)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2044115Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2044116Protein automated matches [190437] (53 species)
    not a true protein
  7. 2044196Species Clostridium botulinum [TaxId:1491] [225675] (23 PDB entries)
  8. 2044212Domain d3obta1: 3obt A:863-1067 [265112]
    Other proteins in same PDB: d3obta2, d3obta3, d3obta4
    automated match to d3n7ja1
    complexed with gol, slb

Details for d3obta1

PDB Entry: 3obt (more details), 2 Å

PDB Description: crystal structure of botulinum neurotoxin serotype d ligand binding domain in complex with n-acetylneuraminic acid
PDB Compounds: (A:) Botulinum neurotoxin type D

SCOPe Domain Sequences for d3obta1:

Sequence, based on SEQRES records: (download)

>d3obta1 b.29.1.0 (A:863-1067) automated matches {Clostridium botulinum [TaxId: 1491]}
sindskilslqnkknalvdtsgynaevrvgdnvqlntiytndfklsssgdkiivnlnnni
lysaiyenssvsfwikiskdltnshneytiinsieqnsgwklcirngniewilqdvnrky
kslifdyseslshtgytnkwffvtitnnimgymklyingelkqsqkiedldevkldktiv
fgidenidenqmlwirdfnifskel

Sequence, based on observed residues (ATOM records): (download)

>d3obta1 b.29.1.0 (A:863-1067) automated matches {Clostridium botulinum [TaxId: 1491]}
sindskilslqnkknalvdtsgynaevrvgdnvqlntiytndfklsssgdkiivnlnnns
aiyenssvsfwikiskdltnshneytiinsieqnsgwklcirngniewilqdvnrkyksl
ifdyseslshtgytnkwffvtitnnimgymklyingelkqsqkiedldevkldktivfgi
denidenqmlwirdfnifskel

SCOPe Domain Coordinates for d3obta1:

Click to download the PDB-style file with coordinates for d3obta1.
(The format of our PDB-style files is described here.)

Timeline for d3obta1: