Lineage for d3obra1 (3obr A:863-1067)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (55 species)
    not a true protein
  7. 2375214Species Clostridium botulinum [TaxId:1491] [225675] (24 PDB entries)
  8. 2375218Domain d3obra1: 3obr A:863-1067 [265110]
    Other proteins in same PDB: d3obra2, d3obra3, d3obra4
    automated match to d3n7ja1
    complexed with gol

Details for d3obra1

PDB Entry: 3obr (more details), 1.72 Å

PDB Description: Crystal structure of Botulinum neurotoxin serotype D binding domain
PDB Compounds: (A:) Botulinum neurotoxin type D

SCOPe Domain Sequences for d3obra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3obra1 b.29.1.0 (A:863-1067) automated matches {Clostridium botulinum [TaxId: 1491]}
sindskilslqnkknalvdtsgynaevrvgdnvqlntiytndfklsssgdkiivnlnnni
lysaiyenssvsfwikiskdltnshneytiinsieqnsgwklcirngniewilqdvnrky
kslifdyseslshtgytnkwffvtitnnimgymklyingelkqsqkiedldevkldktiv
fgidenidenqmlwirdfnifskel

SCOPe Domain Coordinates for d3obra1:

Click to download the PDB-style file with coordinates for d3obra1.
(The format of our PDB-style files is described here.)

Timeline for d3obra1: