Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (70 species) not a true protein |
Species Clostridium botulinum [TaxId:1491] [225675] (24 PDB entries) |
Domain d3obra1: 3obr A:863-1067 [265110] Other proteins in same PDB: d3obra2, d3obra3, d3obra4 automated match to d3n7ja1 complexed with gol |
PDB Entry: 3obr (more details), 1.72 Å
SCOPe Domain Sequences for d3obra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3obra1 b.29.1.0 (A:863-1067) automated matches {Clostridium botulinum [TaxId: 1491]} sindskilslqnkknalvdtsgynaevrvgdnvqlntiytndfklsssgdkiivnlnnni lysaiyenssvsfwikiskdltnshneytiinsieqnsgwklcirngniewilqdvnrky kslifdyseslshtgytnkwffvtitnnimgymklyingelkqsqkiedldevkldktiv fgidenidenqmlwirdfnifskel
Timeline for d3obra1: