Lineage for d3o8yb1 (3o8y B:4-114)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2045908Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology
    duplication: has weak internal pseudo twofold symmetry
  4. 2045909Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) (S)
  5. 2045992Family b.12.1.0: automated matches [227174] (1 protein)
    not a true family
  6. 2045993Protein automated matches [226891] (5 species)
    not a true protein
  7. 2045998Species Human (Homo sapiens) [TaxId:9606] [225245] (7 PDB entries)
  8. 2046002Domain d3o8yb1: 3o8y B:4-114 [265108]
    Other proteins in same PDB: d3o8yb2
    automated match to d1loxa2
    complexed with fe2

Details for d3o8yb1

PDB Entry: 3o8y (more details), 2.39 Å

PDB Description: stable-5-lipoxygenase
PDB Compounds: (B:) Arachidonate 5-lipoxygenase

SCOPe Domain Sequences for d3o8yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o8yb1 b.12.1.0 (B:4-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psytvtvatgsqehagtddyiylslvgsagcsekhlldkgsfergavdsydvtvdeelge
iqlvriekrkygsnddwylkyitlktphgdyiefpcyrwitgdvevvlrdg

SCOPe Domain Coordinates for d3o8yb1:

Click to download the PDB-style file with coordinates for d3o8yb1.
(The format of our PDB-style files is described here.)

Timeline for d3o8yb1: