Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) |
Protein Ionotropic glutamate receptor 2 (GluR2) amino-terminal domain (ATD) [267661] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [267740] (5 PDB entries) |
Domain d3o2jb_: 3o2j B: [265106] automated match to d3h5va_ complexed with nag; mutant |
PDB Entry: 3o2j (more details), 1.95 Å
SCOPe Domain Sequences for d3o2jb_:
Sequence, based on SEQRES records: (download)
>d3o2jb_ c.93.1.1 (B:) Ionotropic glutamate receptor 2 (GluR2) amino-terminal domain (ATD) {Norway rat (Rattus norvegicus) [TaxId: 10116]} iqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtaafcsqfsrgvy aifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyqwd kfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkkerr vildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqivdyd dslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrrgn agdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngprki gywsevdkmvvtlt
>d3o2jb_ c.93.1.1 (B:) Ionotropic glutamate receptor 2 (GluR2) amino-terminal domain (ATD) {Norway rat (Rattus norvegicus) [TaxId: 10116]} iqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtaafcsqfsrgvy aifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyqwd kfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkkerr vildcerdkvndivdqvitvkgyhyiianlgftdgdllkiqfgganvsgfqivdyddslv skfierwstleekeypgahtatikytsaltydavqvmteafrnlrrgnagdclanpavpw gqgveieralkqvqveglsgnikfdqngkrinytinimelktngprkigywsevdkmvvt lt
Timeline for d3o2jb_: