Lineage for d3o2jb_ (3o2j B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143710Family c.93.1.1: L-arabinose binding protein-like [53823] (18 protein domains)
  6. 2143811Protein Ionotropic glutamate receptor 2 (GluR2) amino-terminal domain (ATD) [267661] (1 species)
  7. 2143812Species Norway rat (Rattus norvegicus) [TaxId:10116] [267740] (5 PDB entries)
  8. 2143816Domain d3o2jb_: 3o2j B: [265106]
    automated match to d3h5va_
    complexed with nag; mutant

Details for d3o2jb_

PDB Entry: 3o2j (more details), 1.95 Å

PDB Description: Structure of the GluA2 NTD-dimer interface mutant, N54A
PDB Compounds: (B:) Glutamate receptor 2

SCOPe Domain Sequences for d3o2jb_:

Sequence, based on SEQRES records: (download)

>d3o2jb_ c.93.1.1 (B:) Ionotropic glutamate receptor 2 (GluR2) amino-terminal domain (ATD) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
iqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtaafcsqfsrgvy
aifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyqwd
kfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkkerr
vildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqivdyd
dslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrrgn
agdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngprki
gywsevdkmvvtlt

Sequence, based on observed residues (ATOM records): (download)

>d3o2jb_ c.93.1.1 (B:) Ionotropic glutamate receptor 2 (GluR2) amino-terminal domain (ATD) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
iqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtaafcsqfsrgvy
aifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyqwd
kfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkkerr
vildcerdkvndivdqvitvkgyhyiianlgftdgdllkiqfgganvsgfqivdyddslv
skfierwstleekeypgahtatikytsaltydavqvmteafrnlrrgnagdclanpavpw
gqgveieralkqvqveglsgnikfdqngkrinytinimelktngprkigywsevdkmvvt
lt

SCOPe Domain Coordinates for d3o2jb_:

Click to download the PDB-style file with coordinates for d3o2jb_.
(The format of our PDB-style files is described here.)

Timeline for d3o2jb_: