Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) has additional insertions and/or extensions that are not grouped together |
Protein automated matches [190296] (11 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [267861] (7 PDB entries) |
Domain d3o21c_: 3o21 C: [265103] automated match to d3h5va_ complexed with nag, po4 |
PDB Entry: 3o21 (more details), 2.2 Å
SCOPe Domain Sequences for d3o21c_:
Sequence, based on SEQRES records: (download)
>d3o21c_ c.93.1.1 (C:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} fpntisigglfmrntvqehsafrfavqlyntnqnttekpfhlnyhvdhldssnsfsvtna fcsqfsrgvyaifgfydqmsmntltsfcgalhtsfvtpsfptdadvqfviqmrpalkgai lsllsyykwekfvylydtergfsvlqaimeaavqnnwqvtarsvgnikdvqefrriieem drrqekrylidceverintileqvvilgkhsrgyhymlanlgftdillervmhgganitg fqivnnenpmvqqfiqrwvrlderefpeaknaplkytsalthdailviaeafrylrrqrv dvsrrgsagdclanpavpwsqgidieralkmvqvqgmtgniqfdtygrrtnytidvyemk vsgsrkagywneyerfvpf
>d3o21c_ c.93.1.1 (C:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} fpntisigglfmrntvqehsafrfavqlyntnqnttekpfhlnyhvdhldssnsfsvtna fcsqfsrgvyaifgfydqmsmntltsfcgalhtsfvtpsfptdadvqfviqmrpalkgai lsllsyykwekfvylydtergfsvlqaimeaavqnnwqvtarsvgnikdvqefrriieem drrqekrylidceverintileqvvilgkhsrgyhymlanlgftdillervmhgganitg fqivnnenpmvqqfiqrwvrlderefpeaknaplkytsalthdailviaeafrylrrqrv dvsagdclanpavpwsqgidieralkmvqvqgmtgniqfdtygrrtnytidvyemkvsgs rkagywneyerfvpf
Timeline for d3o21c_: