Lineage for d3o1kc_ (3o1k C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1919500Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 1919501Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 1920048Family d.96.1.0: automated matches [227243] (1 protein)
    not a true family
  6. 1920049Protein automated matches [227009] (9 species)
    not a true protein
  7. 1920146Species Vibrio cholerae [TaxId:243277] [267860] (1 PDB entry)
  8. 1920149Domain d3o1kc_: 3o1k C: [265099]
    automated match to d4aeya_
    complexed with edo

Details for d3o1kc_

PDB Entry: 3o1k (more details), 1.95 Å

PDB Description: Crystal structure of putative dihydroneopterin aldolase (FolB) from Vibrio cholerae O1 biovar El Tor str. N16961
PDB Compounds: (C:) Dihydroneopterin aldolase FolB, putative

SCOPe Domain Sequences for d3o1kc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o1kc_ d.96.1.0 (C:) automated matches {Vibrio cholerae [TaxId: 243277]}
smdkvfieqlevittigvydweqqikqklvldlemahdnraagksddvadaldyaqvsqa
vlehieqgrfllvervaeevaelimtrfavpwlrirltkpgavpqakgvgviierar

SCOPe Domain Coordinates for d3o1kc_:

Click to download the PDB-style file with coordinates for d3o1kc_.
(The format of our PDB-style files is described here.)

Timeline for d3o1kc_: