| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) ![]() bind purine or pterin in topologically similar sites between subunits |
| Family d.96.1.0: automated matches [227243] (1 protein) not a true family |
| Protein automated matches [227009] (16 species) not a true protein |
| Species Vibrio cholerae [TaxId:243277] [267860] (1 PDB entry) |
| Domain d3o1ka_: 3o1k A: [265097] automated match to d4aeya_ complexed with edo |
PDB Entry: 3o1k (more details), 1.95 Å
SCOPe Domain Sequences for d3o1ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o1ka_ d.96.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
smdkvfieqlevittigvydweqqikqklvldlemahdnraagksddvadaldyaqvsqa
vlehieqgrfllvervaeevaelimtrfavpwlrirltkpgavpqakgvgviierar
Timeline for d3o1ka_: