Lineage for d3nyud_ (3nyu D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897767Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [225932] (10 PDB entries)
  8. 2897777Domain d3nyud_: 3nyu D: [265096]
    automated match to d2ogea_
    complexed with edo, na

Details for d3nyud_

PDB Entry: 3nyu (more details), 1.5 Å

PDB Description: x-ray crystal structure of the wbpe (wlbe) aminotransferase from pseudomonas aeruginosa as the plp internal aldimine adduct with lysine 185
PDB Compounds: (D:) Aminotransferase WbpE

SCOPe Domain Sequences for d3nyud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nyud_ c.67.1.0 (D:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
iefidlknqqarikdkidagiqrvlrhgqyilgpevteledrladfvgakyciscangtd
alqivqmalgvgpgdevitpgftyvataetvallgakpvyvdidprtynldpqlleaait
prtkaiipvslygqcadfdainaiaskygipviedaaqsfgasykgkrscnlstvactsf
fpskplgcygdggaiftnddelatairqiarhgqdrryhhirvgvnsrldtlqaaillpk
leifeeeialrqkvaaeydlslkqvgigtpfievnnisvyaqytvrmdnresvqaslkaa
gvptavhypiplnkqpavadekaklpvgdkaatqvmslpmhpyldtasikiicaalt

SCOPe Domain Coordinates for d3nyud_:

Click to download the PDB-style file with coordinates for d3nyud_.
(The format of our PDB-style files is described here.)

Timeline for d3nyud_: