Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (166 species) not a true protein |
Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [225932] (10 PDB entries) |
Domain d3nyud_: 3nyu D: [265096] automated match to d2ogea_ complexed with edo, na |
PDB Entry: 3nyu (more details), 1.5 Å
SCOPe Domain Sequences for d3nyud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nyud_ c.67.1.0 (D:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} iefidlknqqarikdkidagiqrvlrhgqyilgpevteledrladfvgakyciscangtd alqivqmalgvgpgdevitpgftyvataetvallgakpvyvdidprtynldpqlleaait prtkaiipvslygqcadfdainaiaskygipviedaaqsfgasykgkrscnlstvactsf fpskplgcygdggaiftnddelatairqiarhgqdrryhhirvgvnsrldtlqaaillpk leifeeeialrqkvaaeydlslkqvgigtpfievnnisvyaqytvrmdnresvqaslkaa gvptavhypiplnkqpavadekaklpvgdkaatqvmslpmhpyldtasikiicaalt
Timeline for d3nyud_: