![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
![]() | Protein automated matches [190151] (166 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [267859] (5 PDB entries) |
![]() | Domain d3nu8b_: 3nu8 B: [265088] automated match to d2ogaa_ |
PDB Entry: 3nu8 (more details), 1.5 Å
SCOPe Domain Sequences for d3nu8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nu8b_ c.67.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} miefidlknqqarikdkidagiqrvlrhgqyilgpevteledrladfvgakyciscangt dalqivqmalgvgpgdevitpgftyvataetvallgakpvyvdidprtynldpqlleaai tprtkaiipvslygqcadfdainaiaskygipviedaaqsfgasykgkrscnlstvacts ffpskplgcygdggaiftnddelatairqiarhgqdrryhhirvgvnsrldtlqaaillp kleifeeeialrqkvaaeydlslkqvgigtpfievnnisvyaqytvrmdnresvqaslka agvptavhypiplnkqpavadekaklpvgdkaatqvmslpmhpyldtasikiicaaltn
Timeline for d3nu8b_: