SCOPe 2.05: Domain d3nu8a_: 3nu8 A:

Lineage for d3nu8a_ (3nu8 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (98 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [267859] (3 PDB entries)

8. Domain d3nu8a_: 3nu8 A: [265087]
   automated match to d2ogaa_

Details for d3nu8a_

PDB Entry: 3nu8, 1.5 Å

PDB Description: WbpE, an Aminotransferase from Pseudomonas aeruginosa Involved in O-antigen Assembly in Complex with the Internal Aldimine

PDB Compounds: (A:) Aminotransferase WbpE

SCOPe Domain Sequences for d3nu8a_:

Sequence; same for both SEQRES and ATOM records:

>d3nu8a_ c.67.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
miefidlknqqarikdkidagiqrvlrhgqyilgpevteledrladfvgakyciscangt
dalqivqmalgvgpgdevitpgftyvataetvallgakpvyvdidprtynldpqlleaai
tprtkaiipvslygqcadfdainaiaskygipviedaaqsfgasykgkrscnlstvacts
ffpskplgcygdggaiftnddelatairqiarhgqdrryhhirvgvnsrldtlqaaillp
kleifeeeialrqkvaaeydlslkqvgigtpfievnnisvyaqytvrmdnresvqaslka
agvptavhypiplnkqpavadekaklpvgdkaatqvmslpmhpyldtasikiicaalt

Timeline for d3nu8a_:

• d3nu8a_ is new in SCOPe 2.05-stable
  
• d3nu8a_ appears in SCOPe 2.06
  
• d3nu8a_ appears in the current release, SCOPe 2.08