Lineage for d3nc3a_ (3nc3 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005545Species Bacillus subtilis [TaxId:1423] [188626] (6 PDB entries)
  8. 2005558Domain d3nc3a_: 3nc3 A: [265078]
    automated match to d1eupa_
    complexed with gol, hem, mg

Details for d3nc3a_

PDB Entry: 3nc3 (more details), 2.66 Å

PDB Description: CYP134A1 structure with a closed substrate binding loop
PDB Compounds: (A:) Cytochrome P450 cypX

SCOPe Domain Sequences for d3nc3a_:

Sequence, based on SEQRES records: (download)

>d3nc3a_ a.104.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
iklfsvlsdqfqnnpyayfsqlreedpvhyeesidsyfisryhdvryilqhpdifttksl
veraepvmrgpvlaqmhgkehsakrrivvrsfigdaldhlsplikqnaenllapylergk
sdlvndfgktfavcvtmdmlgldkrdhekisewhsgvadfitsisqspearahslwcseq
lsqylmpvikerrvnpgsdlisilctseyegmalsdkdilalilnvllaatepadktlal
miyhllnnpeqmndvladrslvpraiaetlrykppvqliprqlsqdtvvggmeikkdtiv
fcmigaanrdpeafeqpdvfnihredlgiksafsgaarhlafgsgihncvgtafakneie
ivanivldkmrnirleedfcyaesglytrgpvsllvafd

Sequence, based on observed residues (ATOM records): (download)

>d3nc3a_ a.104.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
iklfsvlsdqfqnnpyayfsqlreedpvhyeesidsyfisryhdvryilqhpdifttksl
veraepvmrakrrivvrsfigdaldhlsplikqnaenllapylergksdlvndfgktfav
cvtmdmlgldkrdhekisewhsgvadfitsisqspearahslwcseqlsqylmpvikerr
vnpgsdlisilctalsdkdilalilnvllaatepadktlalmiyhllnnpeqmndvladr
slvpraiaetlrykppvqliprqlsqdtvvggmeikkdtivfcmigaanrdpeafeqpdv
fnihredlgiksafsgaarhlafgsgihncvgtafakneieivanivldkmrnirleedf
cyaesglytrgpvsllvafd

SCOPe Domain Coordinates for d3nc3a_:

Click to download the PDB-style file with coordinates for d3nc3a_.
(The format of our PDB-style files is described here.)

Timeline for d3nc3a_: