![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
![]() | Protein Zinc fingers and homeoboxes protein 1, ZHX1 [158242] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [158243] (3 PDB entries) Uniprot Q9UKY1 565-640 |
![]() | Domain d3narb_: 3nar B: [265077] automated match to d2ecca_ complexed with so4 |
PDB Entry: 3nar (more details), 2.6 Å
SCOPe Domain Sequences for d3narb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3narb_ a.4.1.1 (B:) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} gkickktpeqlhmlksafvrtqwpspeeydklakesglartdivswfgdtryawkngnlk wyyyyqsans
Timeline for d3narb_: