Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
Protein automated matches [190896] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188315] (74 PDB entries) |
Domain d3n9ui_: 3n9u I: [265075] automated match to d4c7qa_ protein/RNA complex; complexed with gol |
PDB Entry: 3n9u (more details), 1.92 Å
SCOPe Domain Sequences for d3n9ui_:
Sequence, based on SEQRES records: (download)
>d3n9ui_ d.58.7.0 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vyvgsfswwttdqqliqvirsigvydvvelkfaenrangqskgyaevvvasensvhklle llpgkvlngekvdvrpatrqnlsqfeaqarkr
>d3n9ui_ d.58.7.0 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vyvgsfswwttdqqliqvirsigvydvvelkfaenrangqskgyaevvvvhkllellpgk vlngekvdvrpatrqnlsqfeaqarkr
Timeline for d3n9ui_: