Lineage for d3n9ui_ (3n9u I:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908987Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 1908988Protein automated matches [190896] (9 species)
    not a true protein
  7. 1909006Species Human (Homo sapiens) [TaxId:9606] [188315] (74 PDB entries)
  8. 1909024Domain d3n9ui_: 3n9u I: [265075]
    automated match to d4c7qa_
    protein/RNA complex; complexed with gol

Details for d3n9ui_

PDB Entry: 3n9u (more details), 1.92 Å

PDB Description: Crystal Structure of the Complex between the 25 kDa Subunit and the 59 kDa Subunit (RRM domain) of Human Cleavage Factor Im
PDB Compounds: (I:) Cleavage and polyadenylation specificity factor subunit 7

SCOPe Domain Sequences for d3n9ui_:

Sequence, based on SEQRES records: (download)

>d3n9ui_ d.58.7.0 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vyvgsfswwttdqqliqvirsigvydvvelkfaenrangqskgyaevvvasensvhklle
llpgkvlngekvdvrpatrqnlsqfeaqarkr

Sequence, based on observed residues (ATOM records): (download)

>d3n9ui_ d.58.7.0 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vyvgsfswwttdqqliqvirsigvydvvelkfaenrangqskgyaevvvvhkllellpgk
vlngekvdvrpatrqnlsqfeaqarkr

SCOPe Domain Coordinates for d3n9ui_:

Click to download the PDB-style file with coordinates for d3n9ui_.
(The format of our PDB-style files is described here.)

Timeline for d3n9ui_: