| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
| Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
| Protein automated matches [190896] (11 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries) |
| Domain d3n9ui_: 3n9u I: [265075] automated match to d4c7qa_ protein/RNA complex; complexed with gol |
PDB Entry: 3n9u (more details), 1.92 Å
SCOPe Domain Sequences for d3n9ui_:
Sequence, based on SEQRES records: (download)
>d3n9ui_ d.58.7.0 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vyvgsfswwttdqqliqvirsigvydvvelkfaenrangqskgyaevvvasensvhklle
llpgkvlngekvdvrpatrqnlsqfeaqarkr
>d3n9ui_ d.58.7.0 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vyvgsfswwttdqqliqvirsigvydvvelkfaenrangqskgyaevvvvhkllellpgk
vlngekvdvrpatrqnlsqfeaqarkr
Timeline for d3n9ui_: