![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.24: Head morphogenesis protein gp7 [90246] (1 family) ![]() |
![]() | Family h.1.24.1: Head morphogenesis protein gp7 [90247] (2 proteins) |
![]() | Protein automated matches [254750] (1 species) not a true protein |
![]() | Species Bacillus phage [TaxId:10756] [256300] (2 PDB entries) |
![]() | Domain d3mtue1: 3mtu E:5-283 [265071] Other proteins in same PDB: d3mtue2, d3mtuf2 automated match to d4iffa_ complexed with cl, edo, eoh |
PDB Entry: 3mtu (more details), 2.1 Å
SCOPe Domain Sequences for d3mtue1:
Sequence, based on SEQRES records: (download)
>d3mtue1 h.1.24.1 (E:5-283) automated matches {Bacillus phage [TaxId: 10756]} peehedilnklldpelaqsertealqqlrvnygsfvseyndleekvahakeenlnmhqml dqtllelnn
>d3mtue1 h.1.24.1 (E:5-283) automated matches {Bacillus phage [TaxId: 10756]} peehedilnklldpqsertealqqlrvnygsfvseyndleekvahakeenlnmhqmldqt llelnn
Timeline for d3mtue1: