SCOPe 2.08: Domain d3mtue1: 3mtu E:5-283

Lineage for d3mtue1 (3mtu E:5-283)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.24: Head morphogenesis protein gp7 [90246] (1 family)

5. Family h.1.24.1: Head morphogenesis protein gp7 [90247] (2 proteins)

6. Protein automated matches [254750] (1 species)
   not a true protein

7. Species Bacillus phage [TaxId:10756] [256300] (2 PDB entries)

8. Domain d3mtue1: 3mtu E:5-283 [265071]
   Other proteins in same PDB: d3mtue2, d3mtuf2
   automated match to d4iffa_
   complexed with cl, edo, eoh

Details for d3mtue1

PDB Entry: 3mtu, 2.1 Å

PDB Description: structure of the tropomyosin overlap complex from chicken smooth muscle

PDB Compounds: (E:) Capsid assembly scaffolding protein,Tropomyosin alpha-1 chain

SCOPe Domain Sequences for d3mtue1:

Sequence, based on SEQRES records:

>d3mtue1 h.1.24.1 (E:5-283) automated matches {Bacillus phage [TaxId: 10756]}
peehedilnklldpelaqsertealqqlrvnygsfvseyndleekvahakeenlnmhqml
dqtllelnn

Sequence, based on observed residues (ATOM records):

>d3mtue1 h.1.24.1 (E:5-283) automated matches {Bacillus phage [TaxId: 10756]}
peehedilnklldpqsertealqqlrvnygsfvseyndleekvahakeenlnmhqmldqt
llelnn

Timeline for d3mtue1:

• d3mtue1 first appeared in SCOPe 2.05, called d3mtue_
  
• d3mtue1 appears in SCOPe 2.07