Lineage for d3md3a2 (3md3 A:160-240)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2952471Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2952472Protein automated matches [190896] (11 species)
    not a true protein
  7. 2952473Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189319] (9 PDB entries)
  8. 2952484Domain d3md3a2: 3md3 A:160-240 [265067]
    automated match to d1cvja1
    complexed with gol, so4

Details for d3md3a2

PDB Entry: 3md3 (more details), 2.7 Å

PDB Description: crystal structure of the first two rrm domains of yeast poly(u) binding protein (pub1)
PDB Compounds: (A:) Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1

SCOPe Domain Sequences for d3md3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3md3a2 d.58.7.0 (A:160-240) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dtfnlfvgdlnvnvddetlrnafkdfpsylsghvmwdmqtgssrgygfvsftsqddaqna
mdsmqgqdlngrplrinwaak

SCOPe Domain Coordinates for d3md3a2:

Click to download the PDB-style file with coordinates for d3md3a2.
(The format of our PDB-style files is described here.)

Timeline for d3md3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3md3a1