SCOPe 2.08: Domain d3md3a1: 3md3 A:75-159

Lineage for d3md3a1 (3md3 A:75-159)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189319] (9 PDB entries)

8. Domain d3md3a1: 3md3 A:75-159 [265066]
   automated match to d1cvja1
   complexed with gol, so4

Details for d3md3a1

PDB Entry: 3md3, 2.7 Å

PDB Description: crystal structure of the first two rrm domains of yeast poly(u) binding protein (pub1)

PDB Compounds: (A:) Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1

SCOPe Domain Sequences for d3md3a1:

Sequence, based on SEQRES records:

>d3md3a1 d.58.7.0 (A:75-159) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rvlyvgnldkaitedilkqyfqvggpianikimidknnknvnyafveyhqshdanialqt
lngkqiennivkinwafqsqqsssd

Sequence, based on observed residues (ATOM records):

>d3md3a1 d.58.7.0 (A:75-159) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rvlyvgnldkaitedilkqyfqvggpianikimidknknvnyafveyhqshdanialqtl
ngkqiennivkinwafqsqqsssd

Timeline for d3md3a1:

• d3md3a1 first appeared in SCOPe 2.05
  
• d3md3a1 appears in SCOPe 2.07