Lineage for d3mbef2 (3mbe F:94-188)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (14 species)
    not a true protein
  7. 2025381Species Mouse (Mus musculus) [TaxId:10090] [224855] (494 PDB entries)
  8. 2025952Domain d3mbef2: 3mbe F:94-188 [265065]
    Other proteins in same PDB: d3mbed1, d3mbef1, d3mbef3
    automated match to d2iadb1
    complexed with nag

Details for d3mbef2

PDB Entry: 3mbe (more details), 2.89 Å

PDB Description: TCR 21.30 in complex with MHC class II I-Ag7HEL(11-27)
PDB Compounds: (F:) MHC CLASS II H2-IAg7 BETA CHAIN

SCOPe Domain Sequences for d3mbef2:

Sequence, based on SEQRES records: (download)

>d3mbef2 b.1.1.2 (F:94-188) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rleqpnvaislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngd
wtfqvlvmlemtphqgevytchvehpslkspitvew

Sequence, based on observed residues (ATOM records): (download)

>d3mbef2 b.1.1.2 (F:94-188) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rleqpnvaislsrhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdwtfqvl
vmlemtphqgevytchvehpslkspitvew

SCOPe Domain Coordinates for d3mbef2:

Click to download the PDB-style file with coordinates for d3mbef2.
(The format of our PDB-style files is described here.)

Timeline for d3mbef2: