![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein automated matches [191280] (6 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [225821] (8 PDB entries) |
![]() | Domain d3mbef1: 3mbe F:5-93 [265064] Other proteins in same PDB: d3mbed1, d3mbed2, d3mbef2, d3mbef3 automated match to d1f3jb2 complexed with nag |
PDB Entry: 3mbe (more details), 2.89 Å
SCOPe Domain Sequences for d3mbef1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mbef1 d.19.1.1 (F:5-93) automated matches {Mouse (Mus musculus) [TaxId: 10090]} rhfvhqfkgecyftngtqrirlvtryiynreeylrfdsdvgeyravtelgrhsaeyynkq ylertraeldtacrhnyeetevptslr
Timeline for d3mbef1: