Lineage for d3mbef1 (3mbe F:5-93)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2163004Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2163005Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2163006Family d.19.1.1: MHC antigen-recognition domain [54453] (13 protein domains)
  6. 2163926Protein automated matches [191280] (3 species)
    not a true protein
  7. 2163974Species Mouse (Mus musculus) [TaxId:10090] [225821] (5 PDB entries)
  8. 2163983Domain d3mbef1: 3mbe F:5-93 [265064]
    Other proteins in same PDB: d3mbed1, d3mbed2, d3mbef2, d3mbef3
    automated match to d1f3jb2
    complexed with nag

Details for d3mbef1

PDB Entry: 3mbe (more details), 2.89 Å

PDB Description: TCR 21.30 in complex with MHC class II I-Ag7HEL(11-27)
PDB Compounds: (F:) MHC CLASS II H2-IAg7 BETA CHAIN

SCOPe Domain Sequences for d3mbef1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mbef1 d.19.1.1 (F:5-93) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rhfvhqfkgecyftngtqrirlvtryiynreeylrfdsdvgeyravtelgrhsaeyynkq
ylertraeldtacrhnyeetevptslr

SCOPe Domain Coordinates for d3mbef1:

Click to download the PDB-style file with coordinates for d3mbef1.
(The format of our PDB-style files is described here.)

Timeline for d3mbef1: