Lineage for d3mbed2 (3mbe D:129-252)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2753154Domain d3mbed2: 3mbe D:129-252 [265063]
    Other proteins in same PDB: d3mbed1, d3mbef1, d3mbef3
    automated match to d1nfdb2
    complexed with nag

Details for d3mbed2

PDB Entry: 3mbe (more details), 2.89 Å

PDB Description: tcr 21.30 in complex with mhc class ii i-ag7hel(11-27)
PDB Compounds: (D:) TCR 21.3 beta chain

SCOPe Domain Sequences for d3mbed2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mbed2 b.1.1.2 (D:129-252) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvctdpq
aykesnysyslssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgra

SCOPe Domain Coordinates for d3mbed2:

Click to download the PDB-style file with coordinates for d3mbed2.
(The format of our PDB-style files is described here.)

Timeline for d3mbed2: