SCOPe 2.08: Domain d3mbed1: 3mbe D:3-128

Lineage for d3mbed1 (3mbe D:3-128)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d3mbed1: 3mbe D:3-128 [265062]
   Other proteins in same PDB: d3mbed2, d3mbef1, d3mbef2, d3mbef3
   automated match to d3c5zb1
   complexed with nag

Details for d3mbed1

PDB Entry: 3mbe, 2.89 Å

PDB Description: tcr 21.30 in complex with mhc class ii i-ag7hel(11-27)

PDB Compounds: (D:) TCR 21.3 beta chain

SCOPe Domain Sequences for d3mbed1:

Sequence; same for both SEQRES and ATOM records:

>d3mbed1 b.1.1.0 (D:3-128) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avtqsprskvavtggkvtlschqtnnhdymywyrqdtghglrlihysyvadstekgdipd
gykasrpsqenfslilelaslsqtavyfcasswdragntlyfgegsrlivve

Timeline for d3mbed1:

• d3mbed1 first appeared in SCOPe 2.05
  
• d3mbed1 appears in SCOPe 2.07