SCOPe 2.07: Domain d3mb8b1: 3mb8 B:4-250

Lineage for d3mb8b1 (3mb8 B:4-250)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.0: automated matches [191488] (1 protein)
   not a true family

6. Protein automated matches [190781] (41 species)
   not a true protein

7. Species Toxoplasma gondii [TaxId:5811] [267856] (1 PDB entry)

8. Domain d3mb8b1: 3mb8 B:4-250 [265061]
   Other proteins in same PDB: d3mb8a2, d3mb8b2
   automated match to d3emva_
   complexed with gol, imh, po4

Details for d3mb8b1

PDB Entry: 3mb8, 1.9 Å

PDB Description: crystal structure of purine nucleoside phosphorylase from toxoplasma gondii in complex with immucillin-h

PDB Compounds: (B:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d3mb8b1:

Sequence; same for both SEQRES and ATOM records:

>d3mb8b1 c.56.2.0 (B:4-250) automated matches {Toxoplasma gondii [TaxId: 5811]}
mqgmevqphirlrkedvepvviivgdparteevanmcekkqelaynreyrsfrvvydsqp
itvishgigcpgtsiaieelaylgakviiragtcgslkpktlkqgdvcvtyaavnetgli
snilpegfpcvatphvyqalmdaakelgieaasgigvtqdyfyqngilpsklemyskccd
vidmemsgvlglcqargiatcgilavdgsplqwdegdydatgvkattgkenmvkitlkac
anlrrqy

Timeline for d3mb8b1:

• d3mb8b1 first appeared in SCOPe 2.05, called d3mb8b_
  
• d3mb8b1 appears in SCOPe 2.06