| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) ![]() complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
| Family c.56.2.0: automated matches [191488] (1 protein) not a true family |
| Protein automated matches [190781] (46 species) not a true protein |
| Species Toxoplasma gondii [TaxId:5811] [267856] (1 PDB entry) |
| Domain d3mb8b1: 3mb8 B:4-250 [265061] Other proteins in same PDB: d3mb8a2, d3mb8b2 automated match to d3emva_ complexed with gol, imh, po4 |
PDB Entry: 3mb8 (more details), 1.9 Å
SCOPe Domain Sequences for d3mb8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mb8b1 c.56.2.0 (B:4-250) automated matches {Toxoplasma gondii [TaxId: 5811]}
mqgmevqphirlrkedvepvviivgdparteevanmcekkqelaynreyrsfrvvydsqp
itvishgigcpgtsiaieelaylgakviiragtcgslkpktlkqgdvcvtyaavnetgli
snilpegfpcvatphvyqalmdaakelgieaasgigvtqdyfyqngilpsklemyskccd
vidmemsgvlglcqargiatcgilavdgsplqwdegdydatgvkattgkenmvkitlkac
anlrrqy
Timeline for d3mb8b1: