Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (61 species) not a true protein |
Species Rhodopseudomonas palustris [TaxId:1076] [267855] (1 PDB entry) |
Domain d3m8nc2: 3m8n C:81-203 [265059] Other proteins in same PDB: d3m8na1, d3m8na3, d3m8nb1, d3m8nb3, d3m8nc1, d3m8nc3 automated match to d3m3ma2 complexed with so4 |
PDB Entry: 3m8n (more details), 2.04 Å
SCOPe Domain Sequences for d3m8nc2:
Sequence, based on SEQRES records: (download)
>d3m8nc2 a.45.1.0 (C:81-203) automated matches {Rhodopseudomonas palustris [TaxId: 1076]} apdtrmdraealqwmffeqhalepnigsayfwlclvkggrdlqthaledwlergyaalqv menhlktndyfaagqltiadialygythvadqcdfdlstfpavnawlrrveqtpgfitmd wtp
>d3m8nc2 a.45.1.0 (C:81-203) automated matches {Rhodopseudomonas palustris [TaxId: 1076]} apdtrmdraealqwmffeqhalepnigsayfwlclledwlergyaalqvmenhlktndyf aagqltiadialygythvadqcdfdlstfpavnawlrrveqtpgfitmdwtp
Timeline for d3m8nc2: