Lineage for d3m8nb2 (3m8n B:81-203)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714186Species Rhodopseudomonas palustris [TaxId:1076] [267855] (1 PDB entry)
  8. 2714188Domain d3m8nb2: 3m8n B:81-203 [265057]
    Other proteins in same PDB: d3m8na1, d3m8na3, d3m8nb1, d3m8nb3, d3m8nc1, d3m8nc3
    automated match to d3m3ma2
    complexed with so4

Details for d3m8nb2

PDB Entry: 3m8n (more details), 2.04 Å

PDB Description: crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris
PDB Compounds: (B:) Possible glutathione S-transferase

SCOPe Domain Sequences for d3m8nb2:

Sequence, based on SEQRES records: (download)

>d3m8nb2 a.45.1.0 (B:81-203) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
apdtrmdraealqwmffeqhalepnigsayfwlclvkggrdlqthaledwlergyaalqv
menhlktndyfaagqltiadialygythvadqcdfdlstfpavnawlrrveqtpgfitmd
wtp

Sequence, based on observed residues (ATOM records): (download)

>d3m8nb2 a.45.1.0 (B:81-203) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
apdtrmdraealqwmffeqhalepaledwlergyaalqvmenhlktndyfaagqltiadi
alygythvadqcdfdlstfpavnawlrrveqtpgfitmdwtp

SCOPe Domain Coordinates for d3m8nb2:

Click to download the PDB-style file with coordinates for d3m8nb2.
(The format of our PDB-style files is described here.)

Timeline for d3m8nb2: