Lineage for d3m8na1 (3m8n A:2-80)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880237Species Rhodopseudomonas palustris [TaxId:1076] [267854] (1 PDB entry)
  8. 2880238Domain d3m8na1: 3m8n A:2-80 [265054]
    Other proteins in same PDB: d3m8na2, d3m8na3, d3m8nb2, d3m8nb3, d3m8nc2, d3m8nc3
    automated match to d3m3ma1
    complexed with so4

Details for d3m8na1

PDB Entry: 3m8n (more details), 2.04 Å

PDB Description: crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris
PDB Compounds: (A:) Possible glutathione S-transferase

SCOPe Domain Sequences for d3m8na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m8na1 c.47.1.0 (A:2-80) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
yklysmqrsgnsykvrlalalldapyravevdilrgesrtpdflaknpsgqvplletapg
rylaesnailwylavgtsl

SCOPe Domain Coordinates for d3m8na1:

Click to download the PDB-style file with coordinates for d3m8na1.
(The format of our PDB-style files is described here.)

Timeline for d3m8na1: