![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
![]() | Protein automated matches [190069] (203 species) not a true protein |
![]() | Species Bacillus cereus [TaxId:226900] [189455] (4 PDB entries) |
![]() | Domain d3m2pe_: 3m2p E: [265052] automated match to d4egba_ complexed with udp |
PDB Entry: 3m2p (more details), 2.95 Å
SCOPe Domain Sequences for d3m2pe_:
Sequence, based on SEQRES records: (download)
>d3m2pe_ c.2.1.0 (E:) automated matches {Bacillus cereus [TaxId: 226900]} slkiavtggtgflgqyvvesikndgntpiiltrsignkaindyeyrvsdytledlinqln dvdavvhlaatrgsqgkisefhdneiltqnlydacyennisnivyastisaysdetslpw nekelplpdlmygvsklacehigniysrkkglciknlrfahlygfneknnyminrffrqa fhgeqltlhansvakreflyakdaaksviyalkqekvsgtfnigsgdaltnyevantinn afgnkdnllvknpnanegihssymdsskakelldfstdynfataveeihllmrg
>d3m2pe_ c.2.1.0 (E:) automated matches {Bacillus cereus [TaxId: 226900]} slkiavtggtgflgqyvvesikndgntpiiltrsigyeyrvsdytledlinqlndvdavv hlaatrgsqgkisefhdneiltqnlydacyennisnivyastisaysdetslpwnekelp lpdlmygvsklacehigniysrkkglciknlrfahlygfneknnyminrffrqafhakre flyakdaaksviyalkqekvsgtfnigsgdaltnyevantinnafgihssymdsskakel ldfstdynfataveeihllmrg
Timeline for d3m2pe_: