Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Bacillus cereus [TaxId:226900] [189455] (5 PDB entries) |
Domain d3m2pe1: 3m2p E:2-293 [265052] Other proteins in same PDB: d3m2pa2, d3m2pb2, d3m2pc2, d3m2pd2, d3m2pd3, d3m2pe2, d3m2pf2 automated match to d4egba_ complexed with udp |
PDB Entry: 3m2p (more details), 2.95 Å
SCOPe Domain Sequences for d3m2pe1:
Sequence, based on SEQRES records: (download)
>d3m2pe1 c.2.1.0 (E:2-293) automated matches {Bacillus cereus [TaxId: 226900]} kiavtggtgflgqyvvesikndgntpiiltrsignkaindyeyrvsdytledlinqlndv davvhlaatrgsqgkisefhdneiltqnlydacyennisnivyastisaysdetslpwne kelplpdlmygvsklacehigniysrkkglciknlrfahlygfneknnyminrffrqafh geqltlhansvakreflyakdaaksviyalkqekvsgtfnigsgdaltnyevantinnaf gnkdnllvknpnanegihssymdsskakelldfstdynfataveeihllmrg
>d3m2pe1 c.2.1.0 (E:2-293) automated matches {Bacillus cereus [TaxId: 226900]} kiavtggtgflgqyvvesikndgntpiiltrsigyeyrvsdytledlinqlndvdavvhl aatrgsqgkisefhdneiltqnlydacyennisnivyastisaysdetslpwnekelplp dlmygvsklacehigniysrkkglciknlrfahlygfneknnyminrffrqafhakrefl yakdaaksviyalkqekvsgtfnigsgdaltnyevantinnafgihssymdsskakelld fstdynfataveeihllmrg
Timeline for d3m2pe1: