Lineage for d3m2pc1 (3m2p C:2-293)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2094408Species Bacillus cereus [TaxId:226900] [189455] (5 PDB entries)
  8. 2094418Domain d3m2pc1: 3m2p C:2-293 [265050]
    Other proteins in same PDB: d3m2pa2, d3m2pb2, d3m2pc2, d3m2pd2, d3m2pd3, d3m2pe2, d3m2pf2
    automated match to d4egba_
    complexed with udp

Details for d3m2pc1

PDB Entry: 3m2p (more details), 2.95 Å

PDB Description: The crystal structure of UDP-N-acetylglucosamine 4-epimerase from Bacillus cereus
PDB Compounds: (C:) UDP-N-acetylglucosamine 4-epimerase

SCOPe Domain Sequences for d3m2pc1:

Sequence, based on SEQRES records: (download)

>d3m2pc1 c.2.1.0 (C:2-293) automated matches {Bacillus cereus [TaxId: 226900]}
kiavtggtgflgqyvvesikndgntpiiltrsignkaindyeyrvsdytledlinqlndv
davvhlaatrgsqgkisefhdneiltqnlydacyennisnivyastisaysdetslpwne
kelplpdlmygvsklacehigniysrkkglciknlrfahlygfneknnyminrffrqafh
geqltlhansvakreflyakdaaksviyalkqekvsgtfnigsgdaltnyevantinnaf
gnkdnllvknpnanegihssymdsskakelldfstdynfataveeihllmrg

Sequence, based on observed residues (ATOM records): (download)

>d3m2pc1 c.2.1.0 (C:2-293) automated matches {Bacillus cereus [TaxId: 226900]}
kiavtggtgflgqyvvesikndgntpiiltrsigndyeyrvsdytledlinqlndvdavv
hlaatrgsqgkisefhdneiltqnlydacyennisnivyastisaysdetslpwnekelp
lpdlmygvsklacehigniysrkkglciknlrfahlygfnenyminrffrqafhgeqltl
hansvakreflyakdaaksviyalkqekvsgtfnigsgdaltnyevantinnafgnkdnl
lvihssymdsskakelldfstdynfataveeihllmrg

SCOPe Domain Coordinates for d3m2pc1:

Click to download the PDB-style file with coordinates for d3m2pc1.
(The format of our PDB-style files is described here.)

Timeline for d3m2pc1:

  • d3m2pc1 first appeared in SCOPe 2.05, called d3m2pc_