Lineage for d3m2pa_ (3m2p A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1830675Species Bacillus cereus [TaxId:226900] [189455] (4 PDB entries)
  8. 1830683Domain d3m2pa_: 3m2p A: [265048]
    automated match to d4egba_
    complexed with udp

Details for d3m2pa_

PDB Entry: 3m2p (more details), 2.95 Å

PDB Description: The crystal structure of UDP-N-acetylglucosamine 4-epimerase from Bacillus cereus
PDB Compounds: (A:) UDP-N-acetylglucosamine 4-epimerase

SCOPe Domain Sequences for d3m2pa_:

Sequence, based on SEQRES records: (download)

>d3m2pa_ c.2.1.0 (A:) automated matches {Bacillus cereus [TaxId: 226900]}
slkiavtggtgflgqyvvesikndgntpiiltrsignkaindyeyrvsdytledlinqln
dvdavvhlaatrgsqgkisefhdneiltqnlydacyennisnivyastisaysdetslpw
nekelplpdlmygvsklacehigniysrkkglciknlrfahlygfneknnyminrffrqa
fhgeqltlhansvakreflyakdaaksviyalkqekvsgtfnigsgdaltnyevantinn
afgnkdnllvknpnanegihssymdsskakelldfstdynfataveeihllmrg

Sequence, based on observed residues (ATOM records): (download)

>d3m2pa_ c.2.1.0 (A:) automated matches {Bacillus cereus [TaxId: 226900]}
slkiavtggtgflgqyvvesikndgntpiiltrsigdyeyrvsdytledlinqlndvdav
vhlaatrgsqgkisefhdneiltqnlydacyennisnivyastisaysdetslpwnekel
plpdlmygvsklacehigniysrkkglciknlrfahlygfnenyminrffrqafhgeqlt
lhansvakreflyakdaaksviyalkqekvsgtfnigsgdaltnyevantinnafgnkdn
llvknpnanegihssymdsskakelldfstdynfataveeihllmrg

SCOPe Domain Coordinates for d3m2pa_:

Click to download the PDB-style file with coordinates for d3m2pa_.
(The format of our PDB-style files is described here.)

Timeline for d3m2pa_:

  • d3m2pa_ is new in SCOPe 2.05-stable
  • d3m2pa_ appears in the current release, SCOPe 2.06, called d3m2pa1