SCOPe 2.08: Domain d3lypb2: 3lyp B:86-207

Lineage for d3lypb2 (3lyp B:86-207)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Pseudomonas fluorescens [TaxId:220664] [255948] (2 PDB entries)

8. Domain d3lypb2: 3lyp B:86-207 [265047]
   Other proteins in same PDB: d3lypa1, d3lypb1
   automated match to d3mdkb2

Details for d3lypb2

PDB Entry: 3lyp, 1.6 Å

PDB Description: structure of stringent starvation protein a homolog from pseudomonas fluorescens

PDB Compounds: (B:) stringent starvation protein A

SCOPe Domain Sequences for d3lypb2:

Sequence; same for both SEQRES and ATOM records:

>d3lypb2 a.45.1.0 (B:86-207) automated matches {Pseudomonas fluorescens [TaxId: 220664]}
llpvypvaransrllihriqrdwcgqvdlildprtkeaarvqarkelresltgvsplfad
kpfflseeqslvdccllpilwrlpvlgielprqakplldymerqfareafqaslsgverd
mr

Timeline for d3lypb2:

• d3lypb2 first appeared in SCOPe 2.05
  
• d3lypb2 appears in SCOPe 2.07