SCOPe 2.08: Domain d3lypb1: 3lyp B:9-85

Lineage for d3lypb1 (3lyp B:9-85)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Pseudomonas fluorescens [TaxId:220664] [255947] (2 PDB entries)

8. Domain d3lypb1: 3lyp B:9-85 [265046]
   Other proteins in same PDB: d3lypa2, d3lypb2
   automated match to d3mdkb1

Details for d3lypb1

PDB Entry: 3lyp, 1.6 Å

PDB Description: structure of stringent starvation protein a homolog from pseudomonas fluorescens

PDB Compounds: (B:) stringent starvation protein A

SCOPe Domain Sequences for d3lypb1:

Sequence, based on SEQRES records:

>d3lypb1 c.47.1.0 (B:9-85) automated matches {Pseudomonas fluorescens [TaxId: 220664]}
lacysdpadhyshrvrivlaekgvsaeiisveagrqppklievnpygslptlvdrdlalw
estvvmeylderyphpp

Sequence, based on observed residues (ATOM records):

>d3lypb1 c.47.1.0 (B:9-85) automated matches {Pseudomonas fluorescens [TaxId: 220664]}
lacysdpadhyshrvrivlaekgvsaeiisveagppklievnpygslptlvdrdlalwes
tvvmeylderyphpp

Timeline for d3lypb1:

• d3lypb1 first appeared in SCOPe 2.05
  
• d3lypb1 appears in SCOPe 2.07