Lineage for d3lypa2 (3lyp A:86-207)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714169Species Pseudomonas fluorescens [TaxId:220664] [255948] (2 PDB entries)
  8. 2714170Domain d3lypa2: 3lyp A:86-207 [265045]
    Other proteins in same PDB: d3lypa1, d3lypb1
    automated match to d3mdkb2

Details for d3lypa2

PDB Entry: 3lyp (more details), 1.6 Å

PDB Description: structure of stringent starvation protein a homolog from pseudomonas fluorescens
PDB Compounds: (A:) stringent starvation protein A

SCOPe Domain Sequences for d3lypa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lypa2 a.45.1.0 (A:86-207) automated matches {Pseudomonas fluorescens [TaxId: 220664]}
llpvypvaransrllihriqrdwcgqvdlildprtkeaarvqarkelresltgvsplfad
kpfflseeqslvdccllpilwrlpvlgielprqakplldymerqfareafqaslsgverd
mr

SCOPe Domain Coordinates for d3lypa2:

Click to download the PDB-style file with coordinates for d3lypa2.
(The format of our PDB-style files is described here.)

Timeline for d3lypa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lypa1